Skip to main content

Advertisement

Springer Nature is making SARS-CoV-2 and COVID-19 research free. View research | View latest news | Sign up for updates

Table 1 Summary of the peptide fragments obtained by MS analysis.

From: Characterization of the human endogenous retrovirus K Gag protein: identification of protease cleavage sites

Gag domains Peptides found by MS analysis
(AA position)
Matrix 31 STKNLIKLFQIIEQFCPWFPEQGTLDLK 58
74 GNIIPLTVWNDWAIIKAALEPFQTEEDSVSVSDAPGSCIIDCNENTR 120
P15 171 VGPSESKPRGTSPLPAGQVPVTLQPQK 197
241 APYPQPPTR 249
260 QGSELHEIIDK 270
Capsid 324 QYGPNSPYMRTLLDSIAHGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVR 379 383 AANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVR 420
430 IQDPGSTCPSFNTVRQGSKEPYPDFVAR 457
499 VPAGSDVISEYVK 511
NC 565 QNITIQATTTGREPPDLCPR 584
602 NGQPLSGNEQR 612
  1. The amino acid position within the Gag protein and an allocation to the Gag subfragments are indicated.